Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 9 (TRGV9)

This Recombinant Human T cell receptor gamma variable 9 (TRGV9) spans the amino acid sequence from region 21-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 9 TRGV9 TCRGV9

UniProt

Q99603

Expression Region

21-122

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AGHLEQPQISSTKTLSKTARLECVVSGITISATSVYWYRERPGEVIQFLVSISYDGTVRKESGIPSGKFEVDRIPETSTSTLTIHNVEKQDIATYYCALWEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 14 Antibody
V4453-100UG 100 µg

Cytokeratin 14 Antibody

Sign In for Pricing
View Details
Innovative Grade US Origin Bovine Mature Uterus Fresh in PBS
IGMBOUTEP 1 Each

Innovative Grade US Origin Bovine Mature Uterus Fresh in PBS

Sign In for Pricing
View Details
C1R siRNA (Human)
orb1867764-01 15 nmol

C1R siRNA (Human)

Sign In for Pricing
View Details
C1R siRNA (Human)
orb1867764-02 30 nmol

C1R siRNA (Human)

Sign In for Pricing
View Details
Monkey Latent Transforming Growth Factor Beta Binding Protein 4 (LTBP4) ELISA Kit
MBS9944240-01 48 Well

Monkey Latent Transforming Growth Factor Beta Binding Protein 4 (LTBP4) ELISA Kit

Sign In for Pricing
View Details
Monkey Latent Transforming Growth Factor Beta Binding Protein 4 (LTBP4) ELISA Kit
MBS9944240-02 96 Well

Monkey Latent Transforming Growth Factor Beta Binding Protein 4 (LTBP4) ELISA Kit

Sign In for Pricing
View Details