Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative pro-MCH-like protein 2 (MCHL2)

This Recombinant Human Putative pro-MCH-like protein 2 (MCHL2) spans the amino acid sequence from region 1-86. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative pro-MCH-like protein 2; Pro-melanin-concentrating hormone-like protein 2; PMCHL2

UniProt

Q9BQD1

Expression Region

1-86

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MLSQKTKKKHNFLNHGLSLNLVIKPYLALEGSVAFPAENGVQDTESTLEKRETGDEENSAKFPIGRRDFDTLRCMLGRVYQRCWQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SETD7 (Center) Rabbit Polyclonal Antibody
AP11177PU-N 400 µL

SETD7 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NEK3 (NM_002498) Human Tagged ORF Clone
RC217714 10 µg

NEK3 (NM_002498) Human Tagged ORF Clone

Sign In for Pricing
View Details
TAAL6 Rabbit pAb, AP conjugated
orb2851501 100 µL

TAAL6 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
Recombinant Human GUCY1A2 Protein, N-His
HW316012-01 50 µg

Recombinant Human GUCY1A2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human GUCY1A2 Protein, N-His
HW316012-02 100 µg

Recombinant Human GUCY1A2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human GUCY1A2 Protein, N-His
HW316012-03 1 mg

Recombinant Human GUCY1A2 Protein, N-His

Sign In for Pricing
View Details