Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Rhomboid domain-containing protein 3 (RHBD3), partial

This Recombinant Human Rhomboid domain-containing protein 3 (RHBD3), partial spans the amino acid sequence from region 184-386. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Rhomboid domain-containing protein 3 RHBDD3 C22orf3

UniProt

Q9Y3P4

Expression Region

184-386

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RWLEPSERRLQVLQEGVLCRTLAGCWPLRLLATPGSLAELPVTHPAGVRPPIPGPPYVASPDLWSHWEDSALPPPSLRPVQPTWEGSSEAGLDWAGASFSPGTPMWAALDEQMLQEGIQASLLDGPAQEPQSAPWLSKSSVSSLRLQQLERMGFPTEQAVVALAATGRVEGAVSLLVGGQVGTETLVTHGKGGPAHSEGPGPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTMR2 (NM_201281) Human Recombinant Protein
TP314811M 100 µg

MTMR2 (NM_201281) Human Recombinant Protein

Sign In for Pricing
View Details
Human AMPK (Phosphorylated Adenosine Monophosphate Activated Protein Kinase) CLIA Kit
E-CL-H0257-01 24 Tests

Human AMPK (Phosphorylated Adenosine Monophosphate Activated Protein Kinase) CLIA Kit

Sign In for Pricing
View Details
Human AMPK (Phosphorylated Adenosine Monophosphate Activated Protein Kinase) CLIA Kit
E-CL-H0257-02 48 Tests

Human AMPK (Phosphorylated Adenosine Monophosphate Activated Protein Kinase) CLIA Kit

Sign In for Pricing
View Details
Human AMPK (Phosphorylated Adenosine Monophosphate Activated Protein Kinase) CLIA Kit
E-CL-H0257-03 96 Tests

Human AMPK (Phosphorylated Adenosine Monophosphate Activated Protein Kinase) CLIA Kit

Sign In for Pricing
View Details
40nm Unconjugated Colloidal Gold
G-40-25 25 mL

40nm Unconjugated Colloidal Gold

Sign In for Pricing
View Details
CEACAM20 (NM_001102600) Human Over-expression Lysate
LY420169 100 µg

CEACAM20 (NM_001102600) Human Over-expression Lysate

Sign In for Pricing
View Details