Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cold shock domain-containing protein C2 (CSDC2)

This Recombinant Human Cold shock domain-containing protein C2 (CSDC2) spans the amino acid sequence from region 1-153. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cold shock domain-containing protein C2; RNA-binding protein PIPPin; CSDC2 PIPPIN

UniProt

Q9Y534

Expression Region

1-153

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCPIPPKNQKFQAVEVVLTQLAPHTPHETWSGQVVGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tubb3 Polyclonal Antibody, APC-Cy7 Conjugated
bs-2670R-APC-Cy7 100 µL

Tubb3 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
TUSC2 Polyclonal Antibody
E-AB-17174-01 20 µL

TUSC2 Polyclonal Antibody

Sign In for Pricing
View Details
TUSC2 Polyclonal Antibody
E-AB-17174-02 60 µL

TUSC2 Polyclonal Antibody

Sign In for Pricing
View Details
TUSC2 Polyclonal Antibody
E-AB-17174-03 120 µL

TUSC2 Polyclonal Antibody

Sign In for Pricing
View Details
TUSC2 Polyclonal Antibody
E-AB-17174-04 200 µL

TUSC2 Polyclonal Antibody

Sign In for Pricing
View Details
Human anti-Flu B HA IgG
E4A11A06-G-100 100 µg

Human anti-Flu B HA IgG

Sign In for Pricing
View Details