Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Insulin-like peptide INSL6 (INSL6), partial

This Recombinant Human Insulin-like peptide INSL6 (INSL6), partial spans the amino acid sequence from region 21-54. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Insulin-like peptide INSL6; Insulin-like peptide 6; Relaxin/insulin-like factor 1; [Cleaved into: Insulin-like peptide INSL6 B chain; Insulin-like peptide INSL6 A chain] INSL6 RIF1

UniProt

Q9Y581

Expression Region

21-54

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RELSDISSARKLCGRYLVKEIEKLCGHANWSQFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXCR1 polyclonal antibody
orb1716843-01 50 µL

CXCR1 polyclonal antibody

Sign In for Pricing
View Details
CXCR1 polyclonal antibody
orb1716843-02 100 µL

CXCR1 polyclonal antibody

Sign In for Pricing
View Details
Anti-RHG05 antibody
STJ191323 200 µl

Anti-RHG05 antibody

Sign In for Pricing
View Details
KIF22 Polyclonal Antibody, Biotin Conjugated
A68862-050 50 μL

KIF22 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Bovine Serum Albumin, Fraction V - Fine Powder
22070016-1 20 g

Bovine Serum Albumin, Fraction V - Fine Powder

Sign In for Pricing
View Details
TRERF1 Antibody
orb681931 100 µL

TRERF1 Antibody

Sign In for Pricing
View Details