Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 265 (TM265), partial

This Recombinant Human Transmembrane protein 265 (TM265), partial spans the amino acid sequence from region 1-33. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 265 TMEM265

UniProt

A0A087WTH1

Expression Region

1-33

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEDEEKAVEILGNTEAAHPPSPIRCCWLRLRCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIX1L (NM_153713) Human Recombinant Protein
TP307865M 100 µg

LIX1L (NM_153713) Human Recombinant Protein

Sign In for Pricing
View Details
Pyrraline
TRC-P997780-2.5MG 2.5 mg

Pyrraline

Sign In for Pricing
View Details
Osteopontin (SPP1) Rabbit Polyclonal Antibody
TA385309 100 µL

Osteopontin (SPP1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
COP (CARD16) (N-term) Rabbit Polyclonal Antibody
AP51022PU-N 400 µL

COP (CARD16) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Cecum
CR559395 5 µg

Tissue Total RNA, Cecum

Sign In for Pricing
View Details
Oxythiamine Monophosphate
TRC-O878515-5MG 5 mg

Oxythiamine Monophosphate

Sign In for Pricing
View Details