Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PIK3R3 upstream open reading frame protein (P3URF)

This Recombinant Human PIK3R3 upstream open reading frame protein (P3URF) spans the amino acid sequence from region 1-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PIK3R3 upstream open reading frame protein P3R3URF

UniProt

A0A087WWA1

Expression Region

1-95

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGPSRLVRGPRPQGMRSPYRRPGMGWPRPRFPRMFKCSRRRYQQGLRGRTASSAAINPATRAMGINNTHTDTTIVWIFPPQVLRHLRQPGIFLIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-Galacturonate
HY-168294 Inquire

D-Galacturonate

Sign In for Pricing
View Details
DMAP1 Rabbit Monoclonal Antibody
E49D1098 100 µL

DMAP1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Coumberol
C8291-5.1 1 mL (10 mM in DMSO)

Coumberol

Sign In for Pricing
View Details
Porcine Scavenger receptor class B member 1
GTR10435474 96 Well

Porcine Scavenger receptor class B member 1

Sign In for Pricing
View Details
Anti Human CD161 Flow Cytometry Monoclonal Clone HP3G10 FITC Ready To Use 100 Tests
IMSAHUCD161HP3G10CFITC100 100 Tests

Anti Human CD161 Flow Cytometry Monoclonal Clone HP3G10 FITC Ready To Use 100 Tests

Sign In for Pricing
View Details
COMMD1 Antibody
orb1334778 100 µg

COMMD1 Antibody

Sign In for Pricing
View Details