Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 131B (D131B)

This Recombinant Human Beta-defensin 131B (D131B) spans the amino acid sequence from region 23-70. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-defensin 131B; Defensin, beta 131; DEFB131B

UniProt

A0A096LNP1

Expression Region

23-70

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

FTSNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIQIDGQKKW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDO1 Antibody
A47527-100UL 100 µL

CDO1 Antibody

Sign In for Pricing
View Details
Anti-C-Myc Antibody (Goat) - Affinity Purified
GMYC-45A-Z 0.1 mg

Anti-C-Myc Antibody (Goat) - Affinity Purified

Sign In for Pricing
View Details
KCMF1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
25323124 3x 1.0µg DNA

KCMF1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Thbs2 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4343304 1.0 µg DNA

Thbs2 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Mouse MTARC2 siRNA
abx923546-01 15 nmol

Mouse MTARC2 siRNA

Sign In for Pricing
View Details
Mouse MTARC2 siRNA
abx923546-02 30 nmol

Mouse MTARC2 siRNA

Sign In for Pricing
View Details