Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 131B (D131B)

This Recombinant Human Beta-defensin 131B (D131B) spans the amino acid sequence from region 23-70. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-defensin 131B; Defensin, beta 131; DEFB131B

UniProt

A0A096LNP1

Expression Region

23-70

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

FTSNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIQIDGQKKW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LGALS2 Antibody
OACD03707-100UL 100 µL

LGALS2 Antibody

Sign In for Pricing
View Details
CORIN (NM_001278585) Human Tagged ORF Clone
RC239804 10 µg

CORIN (NM_001278585) Human Tagged ORF Clone

Sign In for Pricing
View Details
(2R) -2- (1-Oxoisoindoline-2-yl) -4-methylvaleric acid
SYB83884 2.5 g

(2R) -2- (1-Oxoisoindoline-2-yl) -4-methylvaleric acid

Sign In for Pricing
View Details
Quick Step Sheep Bluetongue Virus (BTV) elisa Kit
QS00162Sp-01 48 Tests

Quick Step Sheep Bluetongue Virus (BTV) elisa Kit

Sign In for Pricing
View Details
Quick Step Sheep Bluetongue Virus (BTV) elisa Kit
QS00162Sp-02 96 Tests

Quick Step Sheep Bluetongue Virus (BTV) elisa Kit

Sign In for Pricing
View Details
SµLf2 Rat shRNA Plasmid (Locus ID 311642)
TR703350 1 Kit

SµLf2 Rat shRNA Plasmid (Locus ID 311642)

Sign In for Pricing
View Details