Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein CCDC163 (CC163), partial

This Recombinant Human Transmembrane protein CCDC163 (CC163), partial spans the amino acid sequence from region 55-145. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein CCDC163; Coiled-coil domain-containing protein 163; coiled-coil domain containing 163 pseudogene; CCDC163 C1orf231 CCDC163P

UniProt

A0A0D9SF12

Expression Region

55-145

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GSPPQNSTAVTPAVLWEESEIMQKELKLLQYQLSQHQELLLKQLAEGRQAQVGSWKIPRGAPFLTWSPASFSSMPRVLSKRTYSFGAPKCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zinpyr-1
TRC-Z440000-10MG 10 mg

Zinpyr-1

Sign In for Pricing
View Details
CD63 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F10]
TA803502BM 100 µL

CD63 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F10]

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF488A conjugate, 0.1mg/mL
BNC880257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rchy1 Mouse Gene Knockout Kit (CRISPR)
KN514612 1 Kit

Rchy1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Caspr2 (CNTNAP2) Rabbit Monoclonal Antibody
TA424001 100 µL

Caspr2 (CNTNAP2) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ACSL3 Antibody
OC-365-01 50 μL

ACSL3 Antibody

Sign In for Pricing
View Details