Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Late cornified envelope protein 6A (LCE6A)

This Recombinant Human Late cornified envelope protein 6A (LCE6A) spans the amino acid sequence from region 1-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Late cornified envelope protein 6A LCE6A C1orf44

UniProt

A0A183

Expression Region

1-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSQQKQQSWKPPNVPKCSPPQRSNPCLAPYSTPCGAPHSEGCHSSSQRPEVQKPRRARQKLRCLSRGTTYHCKEEECEGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF32 (NM_001005368) Human Over-expression Lysate
LC423703 20 µg

ZNF32 (NM_001005368) Human Over-expression Lysate

Sign In for Pricing
View Details
RRP12 (NM_015179) Human Recombinant Protein
TP303502L 1 mg

RRP12 (NM_015179) Human Recombinant Protein

Sign In for Pricing
View Details
TVP23A (NM_001079512) Human Over-expression Lysate
LC421505 20 µg

TVP23A (NM_001079512) Human Over-expression Lysate

Sign In for Pricing
View Details
C5ORF33 (NADK2) (NM_001085411) Human Over-expression Lysate
LY421290 100 µg

C5ORF33 (NADK2) (NM_001085411) Human Over-expression Lysate

Sign In for Pricing
View Details
Human UBN1 activation kit by CRISPRa
GA109284 1 Kit

Human UBN1 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Atp6v0d1 activation kit by CRISPRa
GA200334 1 Kit

Mouse Atp6v0d1 activation kit by CRISPRa

Sign In for Pricing
View Details