Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Late cornified envelope protein 6A (LCE6A)

This Recombinant Human Late cornified envelope protein 6A (LCE6A) spans the amino acid sequence from region 1-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Late cornified envelope protein 6A LCE6A C1orf44

UniProt

A0A183

Expression Region

1-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSQQKQQSWKPPNVPKCSPPQRSNPCLAPYSTPCGAPHSEGCHSSSQRPEVQKPRRARQKLRCLSRGTTYHCKEEECEGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2-Nitro-5- (pentafluorosulfanyl) phenyl) acetonitrile
PC405562 1 Each

(2-Nitro-5- (pentafluorosulfanyl) phenyl) acetonitrile

Sign In for Pricing
View Details
Inhibitor hsa-miR-34b-5p AAV miRNA Vector
Amh3057000 500 ng

Inhibitor hsa-miR-34b-5p AAV miRNA Vector

Sign In for Pricing
View Details
Cd74 (NM_010545) Mouse Tagged Lenti ORF Clone
MR225627L4 10 µg

Cd74 (NM_010545) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
(4-Isopropoxy-3- (trifluoromethoxy) phenyl) boronic acid
PC1022271 1 Each

(4-Isopropoxy-3- (trifluoromethoxy) phenyl) boronic acid

Sign In for Pricing
View Details
Flnc (NM_001081185) Mouse Tagged ORF Clone
MR222854 10 µg

Flnc (NM_001081185) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human TTLL10 siRNA
abx905856-01 15 nmol

Human TTLL10 siRNA

Sign In for Pricing
View Details