Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sperm microtubule inner protein 11 (SMI11)

This Recombinant Human Sperm microtubule inner protein 11 (SMI11) spans the amino acid sequence from region 1-131. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sperm microtubule inner protein 11; Testis-expressed protein 49; SPMIP11 TEX49

UniProt

A0A1B0GTD5

Expression Region

1-131

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAFFNLYLLGYQNSFQNKKRNTTEETNQKEPEPTRLPPIISKDGNYSVHQNSHTRYHEAVRKVLLKTFPNQVFRIPLTDAQNFSFWWSHDPGVRPEETMPWIRSPRHCLIKSAMTRFMDHSILNDRTFSLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-SF1 (Ser82) Polyclonal Antibody, Cy7 Conjugated
bs-17680R-Cy7 100 µL

Phospho-SF1 (Ser82) Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Biotin discontinued. see B1750-01K
367299 1 mg

Biotin discontinued. see B1750-01K

Sign In for Pricing
View Details
TNNI3 antibody
10R-6091 100 ul

TNNI3 antibody

Sign In for Pricing
View Details
JUND Peptide - middle region (AAP80739)
AAP80739-100UG 100 µg

JUND Peptide - middle region (AAP80739)

Sign In for Pricing
View Details
Kir2.1 (Kir2.1) Antibody (PE/ATTO 594)
abx443765 100 µg

Kir2.1 (Kir2.1) Antibody (PE/ATTO 594)

Sign In for Pricing
View Details
G4S linker Monoclonal Antibody
A78722-50UL 50 μL

G4S linker Monoclonal Antibody

Sign In for Pricing
View Details