Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc finger protein 475 (ZN475)

This Recombinant Human Zinc finger protein 475 (ZN475) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Zinc finger protein 475 ZNF475

UniProt

A0A1B0GTH9

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MIRRPPAVVCYICGREYGTKSISIHEPQCLKKWHNENNLLPKELRRPVPKKPEVRTITAKGFYDLDALNEAAWTSAHSQLVPCNVCGRTFLPDRLIVHQRSCKPKAAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm14478 AAV Vector (Mouse) (CMV)
21866104 1 µg

Gm14478 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Phospho-NDRG1 (Thr346) Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2431857 100 µL

Phospho-NDRG1 (Thr346) Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Rabbit Anti-Human Bad (phospho Ser91) Polyclonal Antibody
PA90202HU-01 50 µg

Rabbit Anti-Human Bad (phospho Ser91) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Bad (phospho Ser91) Polyclonal Antibody
PA90202HU-02 100 µg

Rabbit Anti-Human Bad (phospho Ser91) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Bad (phospho Ser91) Polyclonal Antibody
PA90202HU-03 500 µg

Rabbit Anti-Human Bad (phospho Ser91) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Bad (phospho Ser91) Polyclonal Antibody
PA90202HU-04 1 mg

Rabbit Anti-Human Bad (phospho Ser91) Polyclonal Antibody

Sign In for Pricing
View Details