Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 272 (TM272), partial

This Recombinant Human Transmembrane protein 272 (TM272), partial spans the amino acid sequence from region 73-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 272 TMEM272

UniProt

A0A1B0GTI8

Expression Region

73-106

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YDSTRMRRLLSKAVVIDDDDDDEYPWRQNAHRYY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coq2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7511008 1.0 µg DNA

Coq2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Itgb6 ORF Vector (Mouse) (pORF)
ORF048164 1.0 µg DNA

Itgb6 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
GAB1 Human Over-expression Lysate
orb1358422 100 µg

GAB1 Human Over-expression Lysate

Sign In for Pricing
View Details
Zagotenemab (MAPT) - Research Grade Biosimilar Antibody
orb1237249 0.1 mg

Zagotenemab (MAPT) - Research Grade Biosimilar Antibody

Sign In for Pricing
View Details
Hsa-miR-6839-3p miRNA Inhibitor
CIH2344-01 10 nmol

Hsa-miR-6839-3p miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-6839-3p miRNA Inhibitor
CIH2344-02 20 nmol

Hsa-miR-6839-3p miRNA Inhibitor

Sign In for Pricing
View Details