Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 272 (TM272), partial

This Recombinant Human Transmembrane protein 272 (TM272), partial spans the amino acid sequence from region 73-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 272 TMEM272

UniProt

A0A1B0GTI8

Expression Region

73-106

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YDSTRMRRLLSKAVVIDDDDDDEYPWRQNAHRYY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P2X2 (P2RX2) (NM_174872) Human Tagged ORF Clone
RG219600 10 µg

P2X2 (P2RX2) (NM_174872) Human Tagged ORF Clone

Sign In for Pricing
View Details
DTL AAV Vector (Human) (CMV)
18642101 1 µg

DTL AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Nebulizer Delivery System with Medium Mouse Holder
NEB-MM 1 Each

Nebulizer Delivery System with Medium Mouse Holder

Sign In for Pricing
View Details
Recombinant Human TIRAP Protein, N-His
E55P2018 50 µg

Recombinant Human TIRAP Protein, N-His

Sign In for Pricing
View Details
Pdzd9 (NM_001040136) Mouse Tagged Lenti ORF Clone
MR222466L3 10 µg

Pdzd9 (NM_001040136) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) AES1 Polyclonal Antibody
MBS9005481 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) AES1 Polyclonal Antibody

Sign In for Pricing
View Details