Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Epididymal protein 13 (EDD13)

This Recombinant Human Epididymal protein 13 (EDD13) spans the amino acid sequence from region 24-161. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Epididymal protein 13 EDDM13

UniProt

A0A1B0GTR0

Expression Region

24-161

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CTPREVATKEKINLLKGIIGLMSRLSPDGLRHNITSLKMPPLVSPQDRTEEEIKKILGLLSLQVLHEETSGCKEEVKPFSGTTPSRKPLPKRKNTWNFLKCAYMVMTYLFVSYNKGDWCYCHYCNLELDIRDDPCCSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human NOCT Protein, N-His-SUMO
MBS1578793-01 0.1 mg

Recombinant Human NOCT Protein, N-His-SUMO

Sign In for Pricing
View Details
Recombinant Human NOCT Protein, N-His-SUMO
MBS1578793-02 1 mg

Recombinant Human NOCT Protein, N-His-SUMO

Sign In for Pricing
View Details
Recombinant Human NOCT Protein, N-His-SUMO
MBS1578793-03 5x 1 mg

Recombinant Human NOCT Protein, N-His-SUMO

Sign In for Pricing
View Details
Rat Receptor Interacting Serine Threonine Kinase 2 (RIPK2) Antibody Pair Kit (with Standard)
MBS2100880-01 5x 96 Tests

Rat Receptor Interacting Serine Threonine Kinase 2 (RIPK2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Receptor Interacting Serine Threonine Kinase 2 (RIPK2) Antibody Pair Kit (with Standard)
MBS2100880-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Rat Receptor Interacting Serine Threonine Kinase 2 (RIPK2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Receptor Interacting Serine Threonine Kinase 2 (RIPK2) Antibody Pair Kit (with Standard)
MBS2100880-03 10x 96 Tests

Rat Receptor Interacting Serine Threonine Kinase 2 (RIPK2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details