Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Epididymal protein 13 (EDD13)

This Recombinant Human Epididymal protein 13 (EDD13) spans the amino acid sequence from region 24-161. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Epididymal protein 13 EDDM13

UniProt

A0A1B0GTR0

Expression Region

24-161

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CTPREVATKEKINLLKGIIGLMSRLSPDGLRHNITSLKMPPLVSPQDRTEEEIKKILGLLSLQVLHEETSGCKEEVKPFSGTTPSRKPLPKRKNTWNFLKCAYMVMTYLFVSYNKGDWCYCHYCNLELDIRDDPCCSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TMEM117 knockdown cell line
ABC-KD15551 1 Vial

Human TMEM117 knockdown cell line

Sign In for Pricing
View Details
RTP1 (NM_153708) Human Tagged Lenti ORF Clone
RC208986L2 10 µg

RTP1 (NM_153708) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant HAdV-7 Uncharacterized 20.6 kDa early Protein (aa 1-189)
VAng-Cr4403-1mgEcoli 1 mg (E. coli)

Recombinant HAdV-7 Uncharacterized 20.6 kDa early Protein (aa 1-189)

Sign In for Pricing
View Details
ACAN Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-61501R-BF647 100 µL

ACAN Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
gamma Synuclein (SNCG) (NM_003087) Human Tagged ORF Clone
RC204173 10 µg

gamma Synuclein (SNCG) (NM_003087) Human Tagged ORF Clone

Sign In for Pricing
View Details
Hsa-miR-3156-5p antagomir
HY-RI00607A-01 5 nmol

Hsa-miR-3156-5p antagomir

Sign In for Pricing
View Details