Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 50 (TEX50), partial

This Recombinant Human Testis-expressed protein 50 (TEX50), partial spans the amino acid sequence from region 96-177. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 50 TEX50

UniProt

A0A1B0GTY4

Expression Region

96-177

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HYLWKKWKKHQKKLKKQASLEKPGNDLESPLINNIDQTLHRVATTASVIYKIWEHRSHHPSSKKIKHCKLKKKSKEEGARRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

METAP2, NT (Methionine Aminopeptidase 2, MetAP 2, MAP 2, Peptidase M 2, Initiation Factor 2-associated 67kD Glycoprotein, p67eIF2) (AP) discontinued
M3016-01A-AP 200 µL

METAP2, NT (Methionine Aminopeptidase 2, MetAP 2, MAP 2, Peptidase M 2, Initiation Factor 2-associated 67kD Glycoprotein, p67eIF2) (AP) discontinued

Sign In for Pricing
View Details
Glod4 (NM_026029) Mouse Tagged ORF Clone
MG204147 10 µg

Glod4 (NM_026029) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
DGKZ, CT (DGKZ, DAGK6, Diacylglycerol kinase zeta, Diglyceride kinase zeta) (Azide free) (HRP) discontinued
034605-HRP 200 µL

DGKZ, CT (DGKZ, DAGK6, Diacylglycerol kinase zeta, Diglyceride kinase zeta) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Renewable Energy Kit
1150110 1 Each

Renewable Energy Kit

Sign In for Pricing
View Details
Rabbit Anti Human TLR8 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 120ul
IRBAHUTLR8AP873120UL 120 µL

Rabbit Anti Human TLR8 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 120ul

Sign In for Pricing
View Details
F37110-0058, Magnetic stirrer sticks
1214179 1 Unit

F37110-0058, Magnetic stirrer sticks

Sign In for Pricing
View Details