Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 48 (TEX48)

This Recombinant Human Testis-expressed protein 48 (TEX48) spans the amino acid sequence from region 1-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 48 TEX48

UniProt

A0A1B0GUV7

Expression Region

1-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAAHQNLILKIFCLCCRDCQEPYAINDSKVPSQTQEHKPSTQNLLLQKDELDRQNPKRINAVSHLPSRTPLIQTKKSTSSSSSEFEDLNAYASQRNFYKRNLNRYCQEHWPFQPCLTGRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1733 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7310302 1.0 µg DNA

Olr1733 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
TM4SF1 cDNA Clone
MBS1270147-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

TM4SF1 cDNA Clone

Sign In for Pricing
View Details
TM4SF1 cDNA Clone
MBS1270147-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

TM4SF1 cDNA Clone

Sign In for Pricing
View Details
VN1R71P 3'UTR Lenti-reporter-Luc Vector
49929081 1.0 µg

VN1R71P 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Rat Urocortin 2 (UCN2) ELISA Kit
RD-UCN2-Ra-01 96 Tests

Rat Urocortin 2 (UCN2) ELISA Kit

Sign In for Pricing
View Details
Rat Urocortin 2 (UCN2) ELISA Kit
RD-UCN2-Ra-02 48 Tests

Rat Urocortin 2 (UCN2) ELISA Kit

Sign In for Pricing
View Details