Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Reelin domain-containing protein 1 (RELD1), partial

This Recombinant Human Reelin domain-containing protein 1 (RELD1), partial spans the amino acid sequence from region 24-443. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Reelin domain-containing protein 1 REELD1

UniProt

A0A1B0GV85

Expression Region

24-443

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

FSHGASTVACDDMQPKHIQAQPQHQDSHHITIHTHRTSYAPGDKIPVTVRSSRDFMGFLLQARRVSDHQIAGTFVLIPPHSKLMTCFQEADAVTHSDKSLKRNLSFVWKAPAQPVGDIKFLLSVVQSYFVYWARIESSVVSQQTHSSAHSDDRMEPRLLMPNLHQRLGDVEGAAPAPRTPITLPQQHTHVFAVALPGAAEEDNLDPVPASIWVTKFPGDAETLSQPSSHTATEGSINQQPSGDSNPTLEPSLEVHRLERLVALKRVSSESFASSLSTHHRTQDDPSFDSLETCLSSDGGEQDKTKASNRTVTQPPLSTVQLTYPQCLWSSETFTGNGVRASNPIPVLQTSGTSGLPAAGDQSEASRASASFLPQSKHKELRAGKGNGEGGVGYPRQTNPRPDIGLEGAQAPLGIQLRTPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine FGF7 ELISA Kit
orb436992-01 48 Tests

Porcine FGF7 ELISA Kit

Sign In for Pricing
View Details
Porcine FGF7 ELISA Kit
orb436992-02 96 Tests

Porcine FGF7 ELISA Kit

Sign In for Pricing
View Details
Human EOLA2 (NM_001013845) AAV Particle
RC209086A1V 250 µL

Human EOLA2 (NM_001013845) AAV Particle

Sign In for Pricing
View Details
C3 Antibody (HRP)
orb243461-01 50 µg

C3 Antibody (HRP)

Sign In for Pricing
View Details
C3 Antibody (HRP)
orb243461-02 100 µg

C3 Antibody (HRP)

Sign In for Pricing
View Details
VASH1 Human qPCR Template Standard (NM_014909)
HK210275 1 Kit

VASH1 Human qPCR Template Standard (NM_014909)

Sign In for Pricing
View Details