Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine protease-like protein 51 (PRS51)

This Recombinant Human Serine protease-like protein 51 (PRS51) spans the amino acid sequence from region 17-220. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Serine protease-like protein 51 PRSS51

UniProt

A0A1B0GVH4

Expression Region

17-220

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QDNPENVQCGHRPAFPNSSWLPFHERLQVQNGECPWQVSIQMSRKHLCGGSILHWWWVLTAAHCFRRTLLDMAVVNVTVVMGTRTFSNIHSERKQVQKEEERTWDWCWMAQWVTTNGYDQYDDLNMHLEKLRVVQISRKECAKRINQLSRNMICAWNEPGTNGIFKVLTPAQPPPPSRETVGHLWFVLFMEPRDSSKWVSSVGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Polyclonal NIR2 Antibody
NB100-1417 0.1 mg

Goat Polyclonal NIR2 Antibody

Sign In for Pricing
View Details
Mouse anti Human VWC2 Monoclonal Antibody
MBS2543680-01 0.06 mL

Mouse anti Human VWC2 Monoclonal Antibody

Sign In for Pricing
View Details
Mouse anti Human VWC2 Monoclonal Antibody
MBS2543680-02 0.12 mL

Mouse anti Human VWC2 Monoclonal Antibody

Sign In for Pricing
View Details
Mouse anti Human VWC2 Monoclonal Antibody
MBS2543680-03 0.2 mL

Mouse anti Human VWC2 Monoclonal Antibody

Sign In for Pricing
View Details
NPDC1 siRNA (Human)
orb1857099-01 15 nmol

NPDC1 siRNA (Human)

Sign In for Pricing
View Details
NPDC1 siRNA (Human)
orb1857099-02 30 nmol

NPDC1 siRNA (Human)

Sign In for Pricing
View Details