Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C11orf97 (CK097)

This Recombinant Human Uncharacterized protein C11orf97 (CK097) spans the amino acid sequence from region 1-126. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C11orf97 C11orf97

UniProt

A0A1B0GVM6

Expression Region

1-126

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTGEEAVVVTAVVAPKAGREEEQPPPPAGLGCGARGEPGRGPLEHGQQWKKFLYCEPHKRIKEVLEEERHIKRDECHIKNPAAVALEGIWSIKRNLPVGGLKPGLPSRNSLLPQAKYYSRHGGLRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BORG4 Antibody
8C15025-AAT 50 µg

BORG4 Antibody

Sign In for Pricing
View Details
PDPK1 pSer241 Rabbit Polyclonal Antibody
AP02307PU-S 50 µL

PDPK1 pSer241 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS624690 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Swabzymes-Oxidase Reagent Swabs
13-106-50 1 Each

Swabzymes-Oxidase Reagent Swabs

Sign In for Pricing
View Details
XLF (NHEJ1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F3]
TA502003BM 100 µL

XLF (NHEJ1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F3]

Sign In for Pricing
View Details
N-Acetyl-L-(-)-leucine
TRC-A185035-25G 25 g

N-Acetyl-L-(-)-leucine

Sign In for Pricing
View Details