Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C11orf97 (CK097)

This Recombinant Human Uncharacterized protein C11orf97 (CK097) spans the amino acid sequence from region 1-126. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C11orf97 C11orf97

UniProt

A0A1B0GVM6

Expression Region

1-126

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTGEEAVVVTAVVAPKAGREEEQPPPPAGLGCGARGEPGRGPLEHGQQWKKFLYCEPHKRIKEVLEEERHIKRDECHIKNPAAVALEGIWSIKRNLPVGGLKPGLPSRNSLLPQAKYYSRHGGLRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OTX3 (E-9) Alexa Fluor® 546
sc-515294 AF546 200 µg/mL

OTX3 (E-9) Alexa Fluor® 546

Sign In for Pricing
View Details
Anti-RASAL3 Antibody Picoband® FITC Conjugated
A11713-1-FITC 100 µg/Vial

Anti-RASAL3 Antibody Picoband® FITC Conjugated

Sign In for Pricing
View Details
Beta Amyloid (1-33) peptide
orb1090664 5 mg

Beta Amyloid (1-33) peptide

Sign In for Pricing
View Details
Mouse BAG Family Molecular Chaperone Regulator 4 (BAG4) ELISA Kit
abx503483 96 Tests

Mouse BAG Family Molecular Chaperone Regulator 4 (BAG4) ELISA Kit

Sign In for Pricing
View Details
CSTF2T Antibody
orb194501-01 50 μL

CSTF2T Antibody

Sign In for Pricing
View Details
CSTF2T Antibody
orb194501-02 100 µL

CSTF2T Antibody

Sign In for Pricing
View Details