Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C2orf92 (CB092), partial

This Recombinant Human Uncharacterized protein C2orf92 (CB092), partial spans the amino acid sequence from region 21-191. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C2orf92; Long intergenic non-protein coding RNA 1125; C2orf92 LINC01125

UniProt

A0A1B0GVN3

Expression Region

21-191

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVFSKVPYDPSFDETRTAVRSITKRDTQKSYSQQKSLNNAAFASGSNEREEHLAKIFDEILLQVFPKFPYDPSFNEATAVRSITKTDMRKGTSIAWNSPKPEYFLGSVDKIPDKDHLSEEKNFKESCLFDRDLREQLTTIDKETLQGAAKPDAHFRTMPCGQLLHFLQRNT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAE2 / UBA2 Recombinant Antibody, APC Conjugated
bsm-61707R-APC-01 20 µL

SAE2 / UBA2 Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
SAE2 / UBA2 Recombinant Antibody, APC Conjugated
bsm-61707R-APC-02 100 µL

SAE2 / UBA2 Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
PSMD6 Antibody - N-terminal region : FITC (ARP32399_T100-FITC)
ARP32399_T100-FITC 100 µL

PSMD6 Antibody - N-terminal region : FITC (ARP32399_T100-FITC)

Sign In for Pricing
View Details
Grx2 (m) -PR
sc-145788-PR 10 µM - 20 µL

Grx2 (m) -PR

Sign In for Pricing
View Details
USP37 Blocking Peptide
CBP5346-01 1 mg

USP37 Blocking Peptide

Sign In for Pricing
View Details
USP37 Blocking Peptide
CBP5346-02 5 mg

USP37 Blocking Peptide

Sign In for Pricing
View Details