Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human MyoD family inhibitor domain-containing protein 2 (MDFI2)

This Recombinant Human MyoD family inhibitor domain-containing protein 2 (MDFI2) spans the amino acid sequence from region 1-189. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MyoD family inhibitor domain-containing protein 2 MDFIC2

UniProt

A0A1B0GVS7

Expression Region

1-189

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology; Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSETELEKIKVRTAEHLENDKNNISWLKEDTQLTNAKHADEKPINAIVINSVSDFNITDGPAKENPNEKKLSESSTSLSSLEECQTTFSYLQTDTSVHHRDTDEECASLILACLFCQFWDCLLMLPGTCETVCTKMCCPSRRYHHTSDENHSRNDCSCNCDMDCSLFESCHETSECLELAMEISEICYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL
BNC400253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL
BNC470177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF640R conjugate, 0.1mg/mL
BNC400449-500 1x 500 µL

CD104 (UM-A9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF568 conjugate, 0.1mg/mL
BNC680164-500 1x 500 µL

CD28 (204.12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details