Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LITAF domain-containing protein (LITAD)

This Recombinant Human LITAF domain-containing protein (LITAD) spans the amino acid sequence from region 1-72. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LITAF domain-containing protein; LITAF-like protein; LITAFD

UniProt

A0A1B0GVX0

Expression Region

1-72

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPVQAVCPYCGNRIITVTTFVPGALTWLLCTTLFLFGYVLGCCFLAFCIRSLMDVKHSCPVCQRELFYYHRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B85-100x15M-595-PL Continuous Tapes for Printers
013548 1 Box (1 Roll x 1 Roll)

B85-100x15M-595-PL Continuous Tapes for Printers

Sign In for Pricing
View Details
Ribonuclease H1 (RNase H1, RNASEH1, RNH1, Ribonuclease H Type II, H1RNA) (MaxLight 405)
MBS6192308-01 0.1 mL

Ribonuclease H1 (RNase H1, RNASEH1, RNH1, Ribonuclease H Type II, H1RNA) (MaxLight 405)

Sign In for Pricing
View Details
Ribonuclease H1 (RNase H1, RNASEH1, RNH1, Ribonuclease H Type II, H1RNA) (MaxLight 405)
MBS6192308-02 5x 0.1 mL

Ribonuclease H1 (RNase H1, RNASEH1, RNH1, Ribonuclease H Type II, H1RNA) (MaxLight 405)

Sign In for Pricing
View Details
E. Coli DnaK (508-638 aa) Antibody
32984-05111 150 µg

E. Coli DnaK (508-638 aa) Antibody

Sign In for Pricing
View Details
Proteasome Subunit Beta Type 1 (PSMB1) Antibody
abx122050-01 100 µg

Proteasome Subunit Beta Type 1 (PSMB1) Antibody

Sign In for Pricing
View Details
Proteasome Subunit Beta Type 1 (PSMB1) Antibody
abx122050-02 1 mg

Proteasome Subunit Beta Type 1 (PSMB1) Antibody

Sign In for Pricing
View Details