Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 33 (SIM33), partial

This Recombinant Human Small integral membrane protein 33 (SIM33), partial spans the amino acid sequence from region 64-132. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 33 SMIM33

UniProt

A0A1B0GW64

Expression Region

64-132

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HFGPRLHQGHATLPTEPPTPKPDGGIYLIHWRVLGPQDSPEEAPPGPLVPGSCPAPDGPRPSIDEVTCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDHGC5 Protein Vector (Human) (pPM-C-HA)
36186021 500 ng

PCDHGC5 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Rat Monoclonal B7-2/CD86 Antibody (AP-MAB0803) [Janelia Fluor 646]
NBP2-12182JF646 0.1 mL

Rat Monoclonal B7-2/CD86 Antibody (AP-MAB0803) [Janelia Fluor 646]

Sign In for Pricing
View Details
Lentiviral mouse Tgm6 shRNA (UAS) - Lentiviral mouse Tgm6 shRNA (UAS, iRFP) (100)
GTR15162807 1 Vial

Lentiviral mouse Tgm6 shRNA (UAS) - Lentiviral mouse Tgm6 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Anti-SHIP2 Antibody
CPA4033-01 30 µL

Anti-SHIP2 Antibody

Sign In for Pricing
View Details
Anti-SHIP2 Antibody
CPA4033-02 50 μL

Anti-SHIP2 Antibody

Sign In for Pricing
View Details
Anti-SHIP2 Antibody
CPA4033-03 100 µL

Anti-SHIP2 Antibody

Sign In for Pricing
View Details