Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine-rich and transmembrane domain-containing 2 (SRTM2), partial

This Recombinant Human Serine-rich and transmembrane domain-containing 2 (SRTM2), partial spans the amino acid sequence from region 1-37. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Serine-rich and transmembrane domain-containing 2 SERTM2

UniProt

A0A1B0GWG4

Expression Region

1-37

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MMEAHFKYHGNLTGRAHFPTLATEVDTSSDKYSNLYM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLEKHO1 (NM_016274) Human Recombinant Protein
TP303969 20 µg

PLEKHO1 (NM_016274) Human Recombinant Protein

Sign In for Pricing
View Details
Annexin V, FITC Conjugate
#29001 1x 500 µL

Annexin V, FITC Conjugate

Sign In for Pricing
View Details
ExoBriteTM 410/450 CD9 Flow Antibody (100 tests)
P003-410-500 1x 500 µL

ExoBriteTM 410/450 CD9 Flow Antibody (100 tests)

Sign In for Pricing
View Details
Tissue Embedding System BHTP-603
BHTP-603 1 Unit

Tissue Embedding System BHTP-603

Sign In for Pricing
View Details
8-(2,3-Dichlorophenyl)-8-aza-5-azoniaspiro[4.5]decane Bromide
TRC-D436070-1G 1 g

8-(2,3-Dichlorophenyl)-8-aza-5-azoniaspiro[4.5]decane Bromide

Sign In for Pricing
View Details
Ibuprofen-d3 Alcohol
TRC-I140047-50MG 50 mg

Ibuprofen-d3 Alcohol

Sign In for Pricing
View Details