Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine-rich and transmembrane domain-containing 2 (SRTM2), partial

This Recombinant Human Serine-rich and transmembrane domain-containing 2 (SRTM2), partial spans the amino acid sequence from region 1-37. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Serine-rich and transmembrane domain-containing 2 SERTM2

UniProt

A0A1B0GWG4

Expression Region

1-37

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MMEAHFKYHGNLTGRAHFPTLATEVDTSSDKYSNLYM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCT6A Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV637586 1.0 µg DNA

CCT6A Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Cytochrome C (CYCS/1010), CF488A conjugate, 0.1mg/mL
BNC881010-500 1x 500 µL

Cytochrome C (CYCS/1010), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RSV-IN-10
HY-163567 1 Each

RSV-IN-10

Sign In for Pricing
View Details
GBA3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G8]
TA502542BM 100 µL

GBA3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G8]

Sign In for Pricing
View Details
Rabbit Monoclonal Fc gamma RI/CD64 Antibody (008) [HRP]
NBP2-90404H 0.1 mL

Rabbit Monoclonal Fc gamma RI/CD64 Antibody (008) [HRP]

Sign In for Pricing
View Details
Horse Chemokine C-C Motif Ligand 5 ELISA Kit
MBS031980-01 48 Well

Horse Chemokine C-C Motif Ligand 5 ELISA Kit

Sign In for Pricing
View Details