Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Parvalbumin-like EF-hand-containing protein (PVLEF)

This Recombinant Human Parvalbumin-like EF-hand-containing protein (PVLEF) spans the amino acid sequence from region 1-134. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Parvalbumin-like EF-hand-containing protein PVALEF

UniProt

A0A1B0GWK0

Expression Region

1-134

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEEDFSSQMKKMALAMGTSLSDKDIELLPTDMRHHGSFNYLKFFKHIRKLHASGQLDDAIHTAFQSLDKDKSGFIEWNEIKYILSIIPSSGPTTPLTDEEAEAMIQAADTHGDGRINYEEFSELIKKEKIPKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGSF3 Rabbit Polyclonal Antibody
MBS9514980-01 0.05 mL

IGSF3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IGSF3 Rabbit Polyclonal Antibody
MBS9514980-02 0.1 mL

IGSF3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IGSF3 Rabbit Polyclonal Antibody
MBS9514980-03 5x 0.1 mL

IGSF3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Equus burchellii antiquorum Beta-2-microglobulin (B2M)
MBS1330072-01 0.02 mg (E-Coli)

Recombinant Equus burchellii antiquorum Beta-2-microglobulin (B2M)

Sign In for Pricing
View Details
Recombinant Equus burchellii antiquorum Beta-2-microglobulin (B2M)
MBS1330072-02 0.1 mg (E-Coli)

Recombinant Equus burchellii antiquorum Beta-2-microglobulin (B2M)

Sign In for Pricing
View Details
Recombinant Equus burchellii antiquorum Beta-2-microglobulin (B2M)
MBS1330072-03 0.02 mg (Yeast)

Recombinant Equus burchellii antiquorum Beta-2-microglobulin (B2M)

Sign In for Pricing
View Details