Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ETS domain-containing transcription factor ERF-like (ERFL)

This Recombinant Human ETS domain-containing transcription factor ERF-like (ERFL) spans the amino acid sequence from region 1-354. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ETS domain-containing transcription factor ERF-like; ETS repressor factor-like; ERFL

UniProt

A0A1W2PQ73

Expression Region

1-354

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDCSCVSDLLFAPPALPALWTPGFAFPDWAYKPESSPGSRQIQLWHFILELLQKEEYQGVIAWQGDYGEFVIKDPDEVARLWGIRKCKPHMNYDKLSRALRYYYNKRILHKTKGKRFTYKFNFSKVVLVNYPLLDMAAAATGSPLLLTPSPFGGAPGPDAPPLTPETLQTLFSAPRLGEPGARTPLFTSETDKLRLDSPFPFLGSGATSYSKPPGLLGPYGRAFPEYPWNFNPYLTGPFPKLPPSLYPPHFYPNPLASSLGHLPSSGAGGGPTATPLLASTGEGLGPERPSGLAAAPRLALPGAGGPEAALGGKEDSDSELEITDVSGCSSDSEGDEGLPAPPKAKAGKGGTGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gingerenone A
TRC-G387500-500MG 500 mg

Gingerenone A

Sign In for Pricing
View Details
Recombinant MTX3 Antibody
RC-4552-01 50 μL

Recombinant MTX3 Antibody

Sign In for Pricing
View Details
Recombinant MTX3 Antibody
RC-4552-02 100 µL

Recombinant MTX3 Antibody

Sign In for Pricing
View Details
Recombinant MTX3 Antibody
RC-4552-03 1 mL

Recombinant MTX3 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Joint
CS807499 5x 5 µm

Tissue FFPE Sections, Joint

Sign In for Pricing
View Details
Bak (BAK1) Rabbit Polyclonal Antibody
TA383803 100 µL

Bak (BAK1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details