Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ETS domain-containing transcription factor ERF-like (ERFL)

This Recombinant Human ETS domain-containing transcription factor ERF-like (ERFL) spans the amino acid sequence from region 1-354. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ETS domain-containing transcription factor ERF-like; ETS repressor factor-like; ERFL

UniProt

A0A1W2PQ73

Expression Region

1-354

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDCSCVSDLLFAPPALPALWTPGFAFPDWAYKPESSPGSRQIQLWHFILELLQKEEYQGVIAWQGDYGEFVIKDPDEVARLWGIRKCKPHMNYDKLSRALRYYYNKRILHKTKGKRFTYKFNFSKVVLVNYPLLDMAAAATGSPLLLTPSPFGGAPGPDAPPLTPETLQTLFSAPRLGEPGARTPLFTSETDKLRLDSPFPFLGSGATSYSKPPGLLGPYGRAFPEYPWNFNPYLTGPFPKLPPSLYPPHFYPNPLASSLGHLPSSGAGGGPTATPLLASTGEGLGPERPSGLAAAPRLALPGAGGPEAALGGKEDSDSELEITDVSGCSSDSEGDEGLPAPPKAKAGKGGTGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Nitric Oxide Synthase Interacting Protein (NOSIP)
TRV-0012871-01 10 µg

Recombinant Nitric Oxide Synthase Interacting Protein (NOSIP)

Sign In for Pricing
View Details
Recombinant Nitric Oxide Synthase Interacting Protein (NOSIP)
TRV-0012871-02 50 µg

Recombinant Nitric Oxide Synthase Interacting Protein (NOSIP)

Sign In for Pricing
View Details
Recombinant Nitric Oxide Synthase Interacting Protein (NOSIP)
TRV-0012871-03 100 µg

Recombinant Nitric Oxide Synthase Interacting Protein (NOSIP)

Sign In for Pricing
View Details
Recombinant Nitric Oxide Synthase Interacting Protein (NOSIP)
TRV-0012871-04 200 µg

Recombinant Nitric Oxide Synthase Interacting Protein (NOSIP)

Sign In for Pricing
View Details
Recombinant Nitric Oxide Synthase Interacting Protein (NOSIP)
TRV-0012871-05 500 µg

Recombinant Nitric Oxide Synthase Interacting Protein (NOSIP)

Sign In for Pricing
View Details
Recombinant Nitric Oxide Synthase Interacting Protein (NOSIP)
TRV-0012871-06 1 mg

Recombinant Nitric Oxide Synthase Interacting Protein (NOSIP)

Sign In for Pricing
View Details