Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RNA polymerase II subunit A C-terminal domain phosphatase SSU72 like protein 4 (S72L4)

This Recombinant Human RNA polymerase II subunit A C-terminal domain phosphatase SSU72 like protein 4 (S72L4) spans the amino acid sequence from region 1-194. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RNA polymerase II subunit A C-terminal domain phosphatase SSU72 like protein 4; RNA polymerase II subunit A C-terminal domain phosphatase SSU72L4; CTD phosphatase SSU72L4; EC 3.1.3.16; SSU72L4

UniProt

A0A1W2PQC6

Expression Region

1-194

Origin

Homo sapiens (Human)

Field of Research

Molecular Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MLSSTLRVAVVCVSNVNRSMEAHSILRRKGLSVRSFGTESHVRLPGPRPNRPVVYDFATTYKEMYNDLLRKDRERYTRNGILHILGRNERIKPGPERFQECTDFFDVIFTCEESVYDTVVEDLCSREQQTFQPVHVINMDIQDTLEDATLGAFLICEICQCLQQSDDMEDNLEELLLQMEEKAGKSFLHTVCFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL
BNC742216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL
BNC470391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), 1mg/mL
BNUM0304-50 1x 50 µL

CD106 / VCAM1 (B-K9), 1mg/mL

Sign In for Pricing
View Details
Smooth Muscle Actin (ACTA2/791 +1A4), CF640R conjugate, 0.1mg/mL
BNC401203-500 1x 500 µL

Smooth Muscle Actin (ACTA2/791 +1A4), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BCL2-like 2 (CPTC-BCL2L2-2), CF647 conjugate, 0.1mg/mL
BNC472265-100 1x 100 µL

BCL2-like 2 (CPTC-BCL2L2-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (HP6053 + L1C1), CF488A conjugate, 0.1mg/mL
BNC880755-500 1x 500 µL

Human Kappa Light Chain (HP6053 + L1C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details