Recombinant Human RNA polymerase II subunit A C-terminal domain phosphatase SSU72 like protein 3 (S72L3)

RNA polymerase II subunit A C-terminal domain phosphatase SSU72 like protein 3; RNA polymerase II subunit A C-terminal domain phosphatase SSU72L3; CTD phosphatase SSU72L3; EC 3.1.3.16; SSU72L3

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

MLSSPLRVAVVCVSNVNRSMEAHSILRRKGLSVRSFGTESHVRLPGPRPNRPVVYDFATTYKQMYNDLLRKDRERYTRNGILHILGRNERIKPGPERFQECTDSFDVIFTCEESVYDTVVEDLCSREQQTFQPVHVINMDIQDTLEDATLGAFLICEICQCLQQSDDIEDNLEELLLQMEEKAGKSFLHTVCFY