Recombinant Human TATA-box-binding protein-associated factor 11-like protein 9 (TFKL9)
This Recombinant Human TATA-box-binding protein-associated factor 11-like protein 9 (TFKL9) spans the amino acid sequence from region 1-198. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
TATA-box-binding protein-associated factor 11-like protein 9 TAF11L9
UniProt
A0A1W2PR64
Expression Region
1-198
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
METGRQTGVSAEMLAMPRGLKGSKKDGIPEDLDGNLEAPRDQEGELRSEDVMDLTEGDSEASASAPPAAKRRKTHTKGKKESKPTVDAEEAQRMTTLLSAMSEEQLSRYEVCRRSAFPRARVAGLMRAITGSSVSENAAIAMAGIAKLFVGEVVEEALDVCEMWGETPPLQPKHLREAVRRLKPKGLFPNSNCRRIMF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUM3491-50 1x 50 µL
PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3491), 1mg/mL
Sign In for Pricing
View Details 
