Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TATA-box-binding protein-associated factor 11-like protein 3 (TFKL3)

This Recombinant Human TATA-box-binding protein-associated factor 11-like protein 3 (TFKL3) spans the amino acid sequence from region 1-198. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TATA-box-binding protein-associated factor 11-like protein 3 TAF11L3

UniProt

A0A1W2PRV1

Expression Region

1-198

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

METGRQTGVSAEMLAMPRGLKGSKKDGIPEDLDGNLEAPRDQEGELRSEDVMDLTEGDSEASASAPPAAKRRKTHTKGKKESKPTVDAEEAQRMTTLLSAMSEEQLSRYEVCRRSAFPRARVAGLMRAITGSSVSENAAIAMAGIAKLFVGEVVEEALDVCEMWGETLPLQPKHLREAVRRLKPKGLFPNSNCKRIMF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Cyanophenylhydrazine Hydrochloride
TRC-C987535-1G 1 g

4-Cyanophenylhydrazine Hydrochloride

Sign In for Pricing
View Details
Frozen Tissue Sections, Pancreas
CS630223 5x 5 µm

Frozen Tissue Sections, Pancreas

Sign In for Pricing
View Details
Retinyl Retinoate
TRC-R275555-250MG 250 mg

Retinyl Retinoate

Sign In for Pricing
View Details
SHISA7 Human Gene Knockout Kit (CRISPR)
KN427079 1 Kit

SHISA7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
p53 Antibody
F49538-0.08ML 0.08 mL

p53 Antibody

Sign In for Pricing
View Details
NRG1 (NM_001159995) Human Over-expression Lysate
LY431526 100 µg

NRG1 (NM_001159995) Human Over-expression Lysate

Sign In for Pricing
View Details