Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TATA-box-binding protein-associated factor 11-like protein 3 (TFKL3)

This Recombinant Human TATA-box-binding protein-associated factor 11-like protein 3 (TFKL3) spans the amino acid sequence from region 1-198. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TATA-box-binding protein-associated factor 11-like protein 3 TAF11L3

UniProt

A0A1W2PRV1

Expression Region

1-198

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

METGRQTGVSAEMLAMPRGLKGSKKDGIPEDLDGNLEAPRDQEGELRSEDVMDLTEGDSEASASAPPAAKRRKTHTKGKKESKPTVDAEEAQRMTTLLSAMSEEQLSRYEVCRRSAFPRARVAGLMRAITGSSVSENAAIAMAGIAKLFVGEVVEEALDVCEMWGETLPLQPKHLREAVRRLKPKGLFPNSNCKRIMF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRPV2 Protein Vector (Mouse) (pPM-C-His)
PV242137 500 ng

TRPV2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Thyroxine (T4) (PE) discontinued
T5460-01-PE 100 µL

Thyroxine (T4) (PE) discontinued

Sign In for Pricing
View Details
Human Signaling Lympocytic Actiation Molecule (SLAM) ELISA Kit
IHUSLAMF1KT 1 Each

Human Signaling Lympocytic Actiation Molecule (SLAM) ELISA Kit

Sign In for Pricing
View Details
B7-H6, Fc-Fusion-Avi-Tag (Human)
79383 100 µg

B7-H6, Fc-Fusion-Avi-Tag (Human)

Sign In for Pricing
View Details
Ticagrelor CH2O-β-D-Glucuronide
166818 1 mg

Ticagrelor CH2O-β-D-Glucuronide

Sign In for Pricing
View Details
Met (phospho Tyr1003) Polyclonal Antibody
ABP55235-01 30 µL

Met (phospho Tyr1003) Polyclonal Antibody

Sign In for Pricing
View Details