Recombinant Human Small cysteine and glycine repeat-containing protein 10 (SCGRX)
This Recombinant Human Small cysteine and glycine repeat-containing protein 10 (SCGRX) spans the amino acid sequence from region 1-105. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Small cysteine and glycine repeat-containing protein 10; Keratin-associated protein 28 family pseudogene 2; SCYGR10 KRTAP28p2
UniProt
A0A286YEX9
Expression Region
1-105
Origin
Homo sapiens (Human)
Field of Research
Pharmacology & Drug Discovery
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MGCCGCGGCGGRCSGGCGGGCGGGCGGGCGGGCGGCGGGCGSYTTCRYYRVGCCSSCCPCCRGCCGGCCSTPVICCCRRTCRSCGCGCGKSCCQQKCCCQKQCCC
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
P033-488A-1ML 1x 1 mL
Biotin Recombinant Monoclonal Mouse Antibody (rBN-34), CF®488A Conjugate - Biotium Choice
Sign In for Pricing
View Details 
BNC472197-500 1x 500 µL
HCG-beta (Pregnancy & Choriocarcinoma Marker) (rHCGb/54), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details