Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small cysteine and glycine repeat-containing protein 5 (SCGR5)

This Recombinant Human Small cysteine and glycine repeat-containing protein 5 (SCGR5) spans the amino acid sequence from region 1-85. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small cysteine and glycine repeat-containing protein 5; Keratin-associated protein 28-5; SCYGR5 KRTAP28-5

UniProt

A0A286YF46

Expression Region

1-85

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCGCGGCGGCGGGCGGGCGSCTTCRCYRVGCCSSCCPCCRGCCGGCCSTPVICCCRRTCCSCGCGCGKGCCQQKGCCQKQCCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nkx6-2 ORF Vector (Mouse) (pORF)
ORF051426 1.0 µg DNA

Nkx6-2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Rabbit Monoclonal EPX Antibody (EPX/3908R) [mFluor Violet 450 SE]
NBP3-08476MFV450 0.1 mL

Rabbit Monoclonal EPX Antibody (EPX/3908R) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
TMEM106A-AS1 AAV Vector (Human) (CMV)
46860101 1 µg

TMEM106A-AS1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Follistatin (FST) Rabbit Polyclonal Antibody
TA315058 100 µL

Follistatin (FST) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal RalB Antibody (OTI2C4) [DyLight 550]
NBP2-73785R 0.1 mL

Mouse Monoclonal RalB Antibody (OTI2C4) [DyLight 550]

Sign In for Pricing
View Details
OR10G7
402816-01 50 µL

OR10G7

Sign In for Pricing
View Details