Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small cysteine and glycine repeat-containing protein 3 (SCGR3)

This Recombinant Human Small cysteine and glycine repeat-containing protein 3 (SCGR3) spans the amino acid sequence from region 1-100. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small cysteine and glycine repeat-containing protein 3; Keratin-associated protein 28-3; SCYGR3 KRTAP28-3

UniProt

A0A286YF60

Expression Region

1-100

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCGCGSCGGCGGGCGGCGGGCGGGCGGGCGGVCGSCTTCRCYRVGCCSSCCPCCRGCCGGCCSTPVICCCRRTCRSCGCGCRKGCCQQKCCCQKQCCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Coronin-1a Antibody (OTI1A5) [HRP]
NBP2-71680H 0.1 mL

Mouse Monoclonal Coronin-1a Antibody (OTI1A5) [HRP]

Sign In for Pricing
View Details
Rabbit Polyclonal MSRB3 Antibody
NBP1-84259 0.1 mL

Rabbit Polyclonal MSRB3 Antibody

Sign In for Pricing
View Details
ZC3HAV1L Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
50752062 1.0 µg DNA

ZC3HAV1L Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
CBFB
FP-027 100 µL - 10 Tests

CBFB

Sign In for Pricing
View Details
Lentiviral human TMEM87A sgRNA gene knockout kit - Lentiviral human TMEM87A sgRNA gene knockout kit (25)
GTR15367425 1 Vial

Lentiviral human TMEM87A sgRNA gene knockout kit - Lentiviral human TMEM87A sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
D-Biotin
40200080-4 25 g

D-Biotin

Sign In for Pricing
View Details