Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Oocyte-secreted protein 4B (OSP4B)

This Recombinant Human Oocyte-secreted protein 4B (OSP4B) spans the amino acid sequence from region 14-160. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Oocyte-secreted protein 4B OOSP4B

UniProt

A0A2R8Y4Y8

Expression Region

14-160

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SDDWLLVRMKIRPFDKNTDIRIGDIHLRDNCPVTRLLSFNYAFSYPVTSCGIKKIMFQTNDDAILSEISYKPRLHTTYEFPVVCFVKRLKFPSVMHFGMSGFDAHTLKEIPQKTKGQESPTPTQSKTWTLNFNSVNKEQLSKKSLYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Crolibulin 25mg
A17010-25 25 mg

Crolibulin 25mg

Sign In for Pricing
View Details
Luc7l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3193008 1.0 µg DNA

Luc7l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
4932411N23Rik sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3324202 1.0 µg DNA

4932411N23Rik sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
IL11RA Antibody - N-terminal region : HRP (ARP46466_P050-HRP)
ARP46466_P050-HRP 100 µL

IL11RA Antibody - N-terminal region : HRP (ARP46466_P050-HRP)

Sign In for Pricing
View Details
Mouse Monoclonal Keratin 31 Antibody (LHTric-1) [Alexa Fluor 700]
NBP2-53114AF700 0.1 mL

Mouse Monoclonal Keratin 31 Antibody (LHTric-1) [Alexa Fluor 700]

Sign In for Pricing
View Details
Polyclonal Antibody to Osteoglycin (OGN)
MBS2002627-01 0.1 mL

Polyclonal Antibody to Osteoglycin (OGN)

Sign In for Pricing
View Details