Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Oocyte-secreted protein 4B (OSP4B)

This Recombinant Human Oocyte-secreted protein 4B (OSP4B) spans the amino acid sequence from region 14-160. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Oocyte-secreted protein 4B OOSP4B

UniProt

A0A2R8Y4Y8

Expression Region

14-160

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SDDWLLVRMKIRPFDKNTDIRIGDIHLRDNCPVTRLLSFNYAFSYPVTSCGIKKIMFQTNDDAILSEISYKPRLHTTYEFPVVCFVKRLKFPSVMHFGMSGFDAHTLKEIPQKTKGQESPTPTQSKTWTLNFNSVNKEQLSKKSLYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP11 Protein Vector (Human) (pPM-C-His)
PV100537 500 ng

MMP11 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Otub1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4712503 1.0 µg DNA

Otub1 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Recombinant Desulfococcus oleovorans Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial
MBS1109752-01 1 mg (E-Coli)

Recombinant Desulfococcus oleovorans Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial

Sign In for Pricing
View Details
Recombinant Desulfococcus oleovorans Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial
MBS1109752-02 1 mg (Yeast)

Recombinant Desulfococcus oleovorans Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial

Sign In for Pricing
View Details
VEGFD Antibody [K3P16]
C15353-100uL*2 2x 100μL

VEGFD Antibody [K3P16]

Sign In for Pricing
View Details
Msx1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6985306 1.0 µg DNA

Msx1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details