Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Oocyte-secreted protein 4B (OSP4B)

This Recombinant Human Oocyte-secreted protein 4B (OSP4B) spans the amino acid sequence from region 14-160. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Oocyte-secreted protein 4B OOSP4B

UniProt

A0A2R8Y4Y8

Expression Region

14-160

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SDDWLLVRMKIRPFDKNTDIRIGDIHLRDNCPVTRLLSFNYAFSYPVTSCGIKKIMFQTNDDAILSEISYKPRLHTTYEFPVVCFVKRLKFPSVMHFGMSGFDAHTLKEIPQKTKGQESPTPTQSKTWTLNFNSVNKEQLSKKSLYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF720P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
51767061 1.0 µg DNA

ZNF720P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Lentiviral mouse Pvalb shRNA (UAS) - Lentiviral mouse Pvalb shRNA (UAS) (100)
GTR15194982 1 Vial

Lentiviral mouse Pvalb shRNA (UAS) - Lentiviral mouse Pvalb shRNA (UAS) (100)

Sign In for Pricing
View Details
CD73/NT5E Human Monoclonal Antibody
orb2975014-01 50 µg

CD73/NT5E Human Monoclonal Antibody

Sign In for Pricing
View Details
CD73/NT5E Human Monoclonal Antibody
orb2975014-02 100 µg

CD73/NT5E Human Monoclonal Antibody

Sign In for Pricing
View Details
Anti-human PCSK9 (Alirocumab Biosimilar)
BIO0245SM-5mg 5 mg

Anti-human PCSK9 (Alirocumab Biosimilar)

Sign In for Pricing
View Details
Reelin (RELN) CytoSection
TS422655P5 25 Slides

Reelin (RELN) CytoSection

Sign In for Pricing
View Details