Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Oocyte-secreted protein 4B (OSP4B)

This Recombinant Human Oocyte-secreted protein 4B (OSP4B) spans the amino acid sequence from region 14-160. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Oocyte-secreted protein 4B OOSP4B

UniProt

A0A2R8Y4Y8

Expression Region

14-160

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SDDWLLVRMKIRPFDKNTDIRIGDIHLRDNCPVTRLLSFNYAFSYPVTSCGIKKIMFQTNDDAILSEISYKPRLHTTYEFPVVCFVKRLKFPSVMHFGMSGFDAHTLKEIPQKTKGQESPTPTQSKTWTLNFNSVNKEQLSKKSLYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GIT1 Polyclonal Conjugated Antibody
C28967 100 µL

GIT1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
TMS1 (PYCARD) Mouse Monoclonal Antibody [Clone 1H6]
E45M14360V-2 50 µL

TMS1 (PYCARD) Mouse Monoclonal Antibody [Clone 1H6]

Sign In for Pricing
View Details
PDE8B CRISPR All-in-one AAV vector set (with saCas9)(Human)
36298151 3x 1.0 µg DNA

PDE8B CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
TrkA-IN-3
MBS5815463 Inquire

TrkA-IN-3

Sign In for Pricing
View Details
Oxsm (NM_001100508) Rat Tagged ORF Clone Lentiviral Particle
RR208622L4V 200 µL

Oxsm (NM_001100508) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3056), CF405S conjugate, 0.1mg/mL
BNC043056-500 1x 500 µL

Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3056), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details