Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Malignant T-cell-amplified sequence 2 (MCTS2)

This Recombinant Human Malignant T-cell-amplified sequence 2 (MCTS2) spans the amino acid sequence from region 1-181. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Malignant T-cell-amplified sequence 2 MCTS2

UniProt

A0A3B3IRV3

Expression Region

1-181

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MFKKFDEKESVSNCIQLKTSVIKGIKSQLVEQFPGIEPWLNQIMPKKDPVKIVRCHEHTEILTVSGELLFFRQRKGPFCPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAVTAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VCAN Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV698933 1.0 µg DNA

VCAN Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
GRP94 Rabbit mAb
E2R381784 100 µL

GRP94 Rabbit mAb

Sign In for Pricing
View Details
Mouse MDC (Macrophage Derived Chemokine) ELISA Kit
EK240627 96 Well

Mouse MDC (Macrophage Derived Chemokine) ELISA Kit

Sign In for Pricing
View Details
Glucokinase (GCK) (NM_000162) Human Mutant ORF Clone
RC401155 10 µg

Glucokinase (GCK) (NM_000162) Human Mutant ORF Clone

Sign In for Pricing
View Details
Moveltipril
MBS5775562 Inquire

Moveltipril

Sign In for Pricing
View Details
pFastBac-M30a Plasmid
PVT37647 2 µg

pFastBac-M30a Plasmid

Sign In for Pricing
View Details