Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative PWWP domain-containing DNA repair factor 4 (PWWP4), partial

This Recombinant Human Putative PWWP domain-containing DNA repair factor 4 (PWWP4), partial spans the amino acid sequence from region 1756-1817. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative PWWP domain-containing DNA repair factor 4 PWWP4

UniProt

A0A494C071

Expression Region

1756-1817

Origin

Homo sapiens (Human)

Field of Research

Molecular Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RGTMVWFKFQDHPFWPAVVKSVSNTDKTARVLLLEANLHHGKRGIQVPLRRLKHLDCKEKEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5 Lipoxygenase/ALOX5 Rabbit Polyclonal Antibody (HRP)
orb2573797 100 µg

5 Lipoxygenase/ALOX5 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Recombinant Human LGALS9 protein, His-tagged
LGALS9-445H 50 µg

Recombinant Human LGALS9 protein, His-tagged

Sign In for Pricing
View Details
Recombinant Human Decorin (DCN)
MBS956778-01 0.02 mg (E-Coli)

Recombinant Human Decorin (DCN)

Sign In for Pricing
View Details
Recombinant Human Decorin (DCN)
MBS956778-02 0.02 mg (Yeast)

Recombinant Human Decorin (DCN)

Sign In for Pricing
View Details
Recombinant Human Decorin (DCN)
MBS956778-03 0.1 mg (E-Coli)

Recombinant Human Decorin (DCN)

Sign In for Pricing
View Details
Recombinant Human Decorin (DCN)
MBS956778-04 0.1 mg (Yeast)

Recombinant Human Decorin (DCN)

Sign In for Pricing
View Details