Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CUB domain-containing protein (SPADH)

This Recombinant Human CUB domain-containing protein (SPADH) spans the amino acid sequence from region 22-137. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CUB domain-containing protein SPADH

UniProt

A0A494C103

Expression Region

22-137

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PFATAPSDCGGHYTDEYGRIFNYAGPKTECVWIIELNPGEIVTVAIPDLKGFACGKEYVEVLDGPPGSESLDRICKAFSTFYYSSSNIITIKYSREPSHPPTFFEIYYFVDAWSTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PD-L1 (CD274) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B12]
TA507122AM 100 µL

PD-L1 (CD274) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B12]

Sign In for Pricing
View Details
OR52A1 Human Gene Knockout Kit (CRISPR)
KN423453 1 Kit

OR52A1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FANCG (NM_004629) Human Recombinant Protein
TP710405 20 µg

FANCG (NM_004629) Human Recombinant Protein

Sign In for Pricing
View Details
EDG1 Recombinant Rabbit monoclonal Antibody [JM10-66]
ET1703-27-50UL 50 µL

EDG1 Recombinant Rabbit monoclonal Antibody [JM10-66]

Sign In for Pricing
View Details
CBP Antibody
SPC-752D 100 µg

CBP Antibody

Sign In for Pricing
View Details
SCTR Antibody
8G742-AAT 50 µg

SCTR Antibody

Sign In for Pricing
View Details