Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CUB domain-containing protein (SPADH)

This Recombinant Human CUB domain-containing protein (SPADH) spans the amino acid sequence from region 22-137. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CUB domain-containing protein SPADH

UniProt

A0A494C103

Expression Region

22-137

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PFATAPSDCGGHYTDEYGRIFNYAGPKTECVWIIELNPGEIVTVAIPDLKGFACGKEYVEVLDGPPGSESLDRICKAFSTFYYSSSNIITIKYSREPSHPPTFFEIYYFVDAWSTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

8-Nitroguanine
TRC-N496010-1MG 1 mg

8-Nitroguanine

Sign In for Pricing
View Details
Human GPSM3 activation kit by CRISPRa
GA111929 1 Kit

Human GPSM3 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Fam228a activation kit by CRISPRa
GA210027 1 Kit

Mouse Fam228a activation kit by CRISPRa

Sign In for Pricing
View Details
1-Pentyl-1H-indazole-3-carboxylic Acid
TRC-P227520-500MG 500 mg

1-Pentyl-1H-indazole-3-carboxylic Acid

Sign In for Pricing
View Details
PEX26 (NM_001127649) Human Over-expression Lysate
LC426835 20 µg

PEX26 (NM_001127649) Human Over-expression Lysate

Sign In for Pricing
View Details
Vitamin D Binding protein (GC) Mouse Monoclonal Antibody [Clone ID: OTI3H10]
CF809180 100 µg

Vitamin D Binding protein (GC) Mouse Monoclonal Antibody [Clone ID: OTI3H10]

Sign In for Pricing
View Details