Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CUB domain-containing protein (SPADH)

This Recombinant Human CUB domain-containing protein (SPADH) spans the amino acid sequence from region 22-137. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CUB domain-containing protein SPADH

UniProt

A0A494C103

Expression Region

22-137

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PFATAPSDCGGHYTDEYGRIFNYAGPKTECVWIIELNPGEIVTVAIPDLKGFACGKEYVEVLDGPPGSESLDRICKAFSTFYYSSSNIITIKYSREPSHPPTFFEIYYFVDAWSTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zcchc24 (NM_001101433) Mouse Untagged Clone
MC211252 10 µg

Zcchc24 (NM_001101433) Mouse Untagged Clone

Sign In for Pricing
View Details
Recombinant Rat CCDC114 Protein, His (Fc)-Avi-tagged
CCDC114-827R 50 µg

Recombinant Rat CCDC114 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Camp Mouse shRNA Plasmid (Locus ID 12796)
TR500391 1 Kit

Camp Mouse shRNA Plasmid (Locus ID 12796)

Sign In for Pricing
View Details
CD117 multiple clones (c-kit, Stem Cell Factor, SCF Receptor, Steel Factor Receptor, Mast Cell Growth Factor, MGF) (APC) discontinued
C2448-08-APC 100 µL

CD117 multiple clones (c-kit, Stem Cell Factor, SCF Receptor, Steel Factor Receptor, Mast Cell Growth Factor, MGF) (APC) discontinued

Sign In for Pricing
View Details
Human SEC13 Protein Lysate
MBS8419171-01 0.02 mg

Human SEC13 Protein Lysate

Sign In for Pricing
View Details
Human SEC13 Protein Lysate
MBS8419171-02 5x 0.02 mg

Human SEC13 Protein Lysate

Sign In for Pricing
View Details